SPIDER-MAN 4: Jon Watts FINALLY Reveals Why He Isn't Returning To Direct The MCU Movie

SPIDER-MAN 4: Jon Watts FINALLY Reveals Why He Isn't Returning To Direct The MCU Movie

Jon Watts will not return to direct the next Spider-Man movie for Marvel Studios and Sony Pictures and now elaborates on why he’s moved on from the MCU to focus on characters and ideas he’s created...

By JoshWilding - Sep 01, 2024 10:09 AM EST
Filed Under: Spider-Man
Source: The Hollywood Reporter

Jon Watts cut his teeth on indie movies like Clown and Cop Car, but his big break came when Marvel Studios and Sony Pictures tapped him to helm 2017's Spider-Man: Homecoming

He'd later return for Spider-Man: Far From Home (2019) and Spider-Man: No Way Home (2021), with the latter presenting more than its fair share of challenges thanks to the pandemic. Still, the threequel was a massive hit and Watts was announced as the director of The Fantastic Four, only to walk away from the project months later. 

Now, the untitled Spider-Man 4 - which is expected to be released between Avengers: Doomsday and Avengers: Secret Wars - finds itself without a director because Watts will not return to helm the wall-crawler's next adventure. 

Talking to The Hollywood Reporter, the filmmaker broke his silence on moving on from the MCU by admitting he's all too aware that following Spider-Man: No Way Home will be near impossible. 

"That was such a specific moment in time, and the reaction to that movie was just so unbelievable," he says, explaining he came to the realisation that, "It’s never going to be like this, ever again."

After working on Star Wars: Skeleton Crew, Watts has focused on Wolfs, a new action-comedy starring George Clooney and Brad Pitt as two rival fixers forced to work together. 

"Sometimes you do an action movie, and all the fun action stuff is given to the second-unit director," he says. "On the Marvel movies, you split up the work because there’s so much to be done. Rarely do you get the Christopher Nolan opportunity to do all of it. On this one, I was like, 'I want to shoot every single shot.'"

While it's easy to read between the lines here to see that Watts is enjoying his freedom outside the confines of the MCU, it seems his reason for not directing Spider-Man 4 or The Fantastic Four: First Steps is because, when all is said and done, these aren't his characters.

"I was just getting started and Marvel came along - and I take full creative ownership over all those films - but Spider-Man is always going to be Stan Lee and Steve Ditko‘s creation," he says. "This was the chance for me to go back to my voice and my vision and my style. Wolfs is mine, and that’s a really good feeling."

It doesn't seem there are any hard feelings, though, because it was back in July when Marvel Studios President Kevin Feige said, "We love Jon. Jon did three of the best Spider-Man films ever for us. He's got lots of things going on now. So we'll probably be looking for somebody else, just because he's busy."

Who do you think should direct Spider-Man 4?

Marisa Tomei Says Watching Tom & Zendaya Fall In Love Was Her Favorite Part Of Filming SPIDER-MAN Trilogy
Related:

Marisa Tomei Says "Watching Tom & Zendaya Fall In Love" Was Her Favorite Part Of Filming SPIDER-MAN Trilogy

SPIDER-MAN 4 Rumored Production Updates May Reveal When We Can Expect Movie To Swing Into Theaters
Recommended For You:

SPIDER-MAN 4 Rumored Production Updates May Reveal When We Can Expect Movie To Swing Into Theaters

DISCLAIMER: ComicBookMovie.com is protected under the DMCA (Digital Millenium Copyright Act) and... [MORE]

ComicBookMovie.com, and/or the user who contributed this post, may earn commissions or revenue through clicks or purchases made through any third-party links contained within the content above.

OptimusCrime
OptimusCrime - 9/1/2024, 9:38 AM
Good😉
vectorsigma
vectorsigma - 9/1/2024, 9:39 AM
Jumping ship at the heigh of your film series is good. Marvel will never get back to that height anyway so move on while you still can and do what you want without bother.
EskimoJ
EskimoJ - 9/1/2024, 10:09 AM
@vectorsigma - Hey, where've you been hiding at?

Missed your unrelenting Marvel negativity.
vectorsigma
vectorsigma - 9/1/2024, 10:44 AM
@EskimoJ - yeah, just got back.

Im only negative in response to what marvel is giving us. I was not negative when watts made his spider-man films and a lot of movies prior to phase 4
harryba11zack
harryba11zack - 9/1/2024, 9:41 AM
good, wasn't a fan of his work. just hope for the next one they get a better director and most importantly a good writing team.
FireandBlood
FireandBlood - 9/1/2024, 9:45 AM
He gave us a consistently good trilogy, and did some fun stuff with Spidey. Now let’s see what the next guy can do.
TheClungerine
TheClungerine - 9/1/2024, 10:03 AM
@FireandBlood -

'consistently good trilogy'

User Comment Image
FireandBlood
FireandBlood - 9/1/2024, 10:33 AM
@TheClungerine - Consistently great, even. They’re all very well written and directed movies that not only restored the franchise to its former glory but took it to new heights.

Between the MCU movies, Spider-Verse movies and PlayStation games, this franchise is in the best state any franchise could hope to be in.
Superspecialawesomeguy
Superspecialawesomeguy - 9/1/2024, 10:55 AM
@FireandBlood - "He gave us a consistently good trilogy"

User Comment Image
ItsNotForMeWahh
ItsNotForMeWahh - 9/1/2024, 11:00 AM
@FireandBlood - Far From Home is good and these people are wack

User Comment Image
TheClungerine
TheClungerine - 9/1/2024, 11:03 AM
@FireandBlood - lmao nah all of those films were carried by good performances from the villains.

For me the first two were OK. Didn't like the writing at all 🤣 I loved the 3rd but that's probably because spiderman1 is a goat level cbm to me
TCronson
TCronson - 9/1/2024, 11:08 AM
@FireandBlood - they are far from well directed or written, but they are kinda consistent and strangle its audience with aggressive fan servince and cinematic universe references, and that's what people want.
FireandBlood
FireandBlood - 9/1/2024, 11:47 AM
@TheClungerine - They weren’t carried by the villains anymore than the first two Raimi movies were, and it’s a testament to how good Holland’s Parker has been that he had a better rivalry with Dafoe’s Goblin than Maguire did.
whynot
whynot - 9/1/2024, 9:45 AM
IMO it always comes down to the money. They should have brought the truck of money in with negotiations
vectorsigma
vectorsigma - 9/1/2024, 10:46 AM
@whynot - he wanted the creative freedom which marvel cannot give him. Its not always about money for these creatives. The Russos for example are not creatives, lolz
TheVisionary25
TheVisionary25 - 9/1/2024, 11:24 AM
@whynot - sure but they are also people who genuinely want to do all kinds of things and expand their creative horizons which seems to be the case here.
Izaizaiza
Izaizaiza - 9/1/2024, 9:46 AM
That's cool. I enjoyed his Spidey films, but I hope the next one feels a little more classic spider-man
marvel72
marvel72 - 9/1/2024, 9:50 AM
I can only watch these movies for Spider-Man and his villains, the supporting cast suck.
Malatrova15
Malatrova15 - 9/1/2024, 9:50 AM
He should be dancin dance
S8R8M
S8R8M - 9/1/2024, 9:58 AM
I am sure he will come back one day or be a creative consultant in the next spiderman.
Good on him wanting to do his own thing.
Batmangina
Batmangina - 9/1/2024, 10:23 AM
End on a the highest possible high - ask Sam Raimi about doing 'One More'

TBH, I now ffwd through any and all non-Spidey scenes - the high school shit is lame.
Gambito
Gambito - 9/1/2024, 10:42 AM
Clearly a hired hand but I’ll give him credit he pulled off 3 movies finally gave us Mysterio, Vulture, Spidey meeting Matt Murdoch and of course No way Home his movies put the film film series back on top I’m actually looking forward to his Clooney movie looks pretty good
Tidaltree
Tidaltree - 9/1/2024, 11:20 AM
A quite elegant way not to say that he doesn't wanna be part in a Sony-driven Spider-Man movie.
ShimmyShimmyYA
ShimmyShimmyYA - 9/1/2024, 11:22 AM
NWH is a hard rewatch
TheVisionary25
TheVisionary25 - 9/1/2024, 11:33 AM
@ShimmyShimmyYA - how so?.

I do think the first half is just decent but the second half elevates the film.

Peter’s arc in that especially remains strong imo.
ShimmyShimmyYA
ShimmyShimmyYA - 9/1/2024, 11:53 AM
@TheVisionary25 - the plot itself it’s fine. It’s the direction , all those over exaggerated hold for applause moments kill the momentum
TheVisionary25
TheVisionary25 - 9/1/2024, 11:58 AM
@ShimmyShimmyYA - hmmmm

I haven’t felt that way but to each their own
ShimmyShimmyYA
ShimmyShimmyYA - 9/1/2024, 12:06 PM
@TheVisionary25 - it’s most evident when the 2 other spiders show up at Ned’s , that long pause bothers me
ShimmyShimmyYA
ShimmyShimmyYA - 9/1/2024, 12:07 PM
I do own all 3 movies so this also me just complaining about a personal thing
TheVisionary25
TheVisionary25 - 9/1/2024, 12:11 PM
@ShimmyShimmyYA - that’s fair

I can see moments in my head where those could have occurred so I understand , everybody’s got their own thing haha

It’s all good

It’s definitely not a perfect movie and I have my issues with it such as if the spell going wrong brought in people who knew Spiders Man identity which is what I think Strange theorizes then how come someone like Electro shows up who didn’t even know Soider Man was white?.

However the movie does a lot well so it’s outweighs the flaws for me.
Amaru
Amaru - 9/1/2024, 11:28 AM
He gave us one of the best action sequences in a comic book movie in my opinion.

User Comment Image
TheVisionary25
TheVisionary25 - 9/1/2024, 11:35 AM
@Amaru - that’s a great sequence

I also dig the apartment fight in NWH and he did a great job with the tension in this scene of HC

?si=BcU9K8yxJ2JAagka

?si=3B2hztC_Xu_uc3je
Amaru
Amaru - 9/1/2024, 11:42 AM
@TheVisionary25 - Yeah, those are definitely great scenes too.
JobinJ
JobinJ - 9/1/2024, 11:30 AM
#zacksnyderdirectedspidermanfilmnow
Vigor
Vigor - 9/1/2024, 11:40 AM
I went from being whelmed by this guy to wanting to give him an ovation for how he wrapped up the trilogy
DravenCorvis
DravenCorvis - 9/1/2024, 11:58 AM
He got to do 3 of them.

To varying levels, all 3 were received well and made a lot of money (moreso in the case of the 3rd one.)

He got in, left his mark, and got out.

Don't blame the guy at all.

Now he is able to do his own thing again with Wolfs, while playing in the Star Wars sandbox.
TheVisionary25
TheVisionary25 - 9/1/2024, 12:15 PM
If you read the full interview (which you should since it’s good) , it definitely seem like he just wanted to do something different after 3 Spidey films in a row over 5 years or so which is fair imo.

Also while I do hope he returns to Marvel one day if he wants to for even a new character , I’m cool with Spidey having someone else at the helm now since it’s a new chapter in his story so it would be nice to get a fresh stamp on it imo.

Watts did well with the first chapter of this Spider Man’s journey which was essentially an extended origin in a way (whether that was the original intention or not) so I commend him for that…

Wolfs & Skeleton Crew look fun imo and i am looking forward to both!!

User Comment Image

User Comment Image

Please log in to post comments.

Don't have an account?
Please Register.

View Recorder